ZNF527 antibody

Name ZNF527 antibody
Supplier Acris Antibodies
Catalog TA345357
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Antigen The immunogen for Anti-ZNF527 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF527. Synthetic peptide located within the following region: LDFSQEEWEWLKPSQKDLYRDVMLENYRNLVWLDWESWCEIEELSPKWFI.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF527
Supplier Page Shop