ZNF528 antibody

Name ZNF528 antibody
Supplier Acris Antibodies
Catalog TA341413
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-ZNF528 antibody: synthetic peptide directed towards the middle region of human ZNF528. Synthetic peptide located within the following region: LTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKTHTDEKPYKCNKCGTA.
Description Rabbit Polyclonal
Gene ZNF528
Supplier Page Shop

Product images