ZNF561 antibody

Name ZNF561 antibody
Supplier Acris Antibodies
Catalog TA341470
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-ZNF561 antibody: synthetic peptide directed towards the C terminal of human ZNF561. Synthetic peptide located within the following region: KKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRRSKH.
Description Rabbit Polyclonal
Gene ZNF561
Supplier Page Shop

Product images