ZNF579 antibody

Name ZNF579 antibody
Supplier Acris Antibodies
Catalog TA345553
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-ZNF579 antibody: synthetic peptide directed towards the middle region of human ZNF579. Synthetic peptide located within the following region: LANIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSAFEMEEEEVDSKAH.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF579
Supplier Page Shop

Product images