ZNF582 antibody
| Name | ZNF582 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341455 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Pig |
| Antigen | The immunogen for anti-ZNF582 antibody: synthetic peptide directed towards the N terminal of human ZNF582. Synthetic peptide located within the following region: SGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQDD. |
| Description | Rabbit Polyclonal |
| Gene | ZNF582 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF582 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate