ZNF583 antibody

Name ZNF583 antibody
Supplier Acris Antibodies
Catalog TA341487
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-ZNF583 antibody: synthetic peptide directed towards the N terminal of human ZNF583. Synthetic peptide located within the following region: TRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLRED.
Description Rabbit Polyclonal
Gene ZNF583
Supplier Page Shop

Product images