ZNF585B antibody
| Name | ZNF585B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341467 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ZNF585B antibody: synthetic peptide directed towards the N terminal of human ZNF585B. Synthetic peptide located within the following region: RKIIGYKPASSQDQKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEKL. |
| Description | Rabbit Polyclonal |
| Gene | ZNF585B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF585B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysate