| Name | ZNF586 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343395 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-ZNF586 antibody is: synthetic peptide directed towards the middle region of Human ZNF586. Synthetic peptide located within the following region: SSSLLQHQRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF586 |
| Supplier Page | Shop |