ZNF627 antibody

Name ZNF627 antibody
Supplier Acris Antibodies
Catalog TA337899
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-ZNF627 antibody: synthetic peptide directed towards the N terminal of human ZNF627. Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF627
Supplier Page Shop

Product images