Name | ZNF642 /ZFP69 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA339833 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
Antigen | The immunogen for Anti-Zfp69 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Zfp69. Synthetic peptide located within the following region: KAFRQRIHLSNHRTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHTGEKPY. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | ZFP69 |
Supplier Page | Shop |