ZNF782 antibody
| Name | ZNF782 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342108 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human |
| Antigen | The immunogen for anti-ZNF782 antibody: synthetic peptide directed towards the N terminal of human ZNF782. Synthetic peptide located within the following region: TNKLLTTEQEISGKPHNRDINIFRARMMPCKCDIAGSACQGLSLMAPHCQ. |
| Description | Rabbit Polyclonal |
| Gene | ZNF782 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF782 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate