ZNF784 antibody

Name ZNF784 antibody
Supplier Acris Antibodies
Catalog TA339844
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for anti-ZNF784 antibody: synthetic peptide directed towards the middle region of human ZNF784. Synthetic peptide located within the following region: ERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNS.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF784
Supplier Page Shop

Product images