ZNF793 antibody
| Name | ZNF793 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342135 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-ZNF793 antibody: synthetic peptide directed towards the middle region of human ZNF793. Synthetic peptide located within the following region: FCGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGE. |
| Description | Rabbit Polyclonal |
| Gene | ZNF793 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZNF793 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate