ZNF862 antibody

Name ZNF862 antibody
Supplier Acris Antibodies
Catalog TA339675
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Guinea Pig, Human, Rabbit, Rat
Antigen The immunogen for anti-ZNF862 antibody: synthetic peptide directed towards the N terminal of human LOC643641. Synthetic peptide located within the following region: EPRESGKAPVTFDDITVYLLQEEWVLLSQQQKELCGSNKLVAPLGPTVAN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene ZNF862
Supplier Page Shop

Product images