| Name | Anti-B3GNT8 Picoband™ Antibody PB9686 |
|---|---|
| Supplier | Boster Bio |
| Catalog | PB9686 |
| Prices | $240.00 |
| Sizes | 1 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC-P WB |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Description | Rabbit Polyclonal |
| Gene | B3GNT8 |
| Supplier Page | Shop |