DOHH antibody

• Supplier: Biorbyt
• Catalog: orb326373
• Prices: $502.00
• Sizes: 100 μl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human, Mouse, Rat, Zebrafish, Guinea Pig, Dog, Horse, Yeast, Pig
• Antigen: Synthetic peptide located within the following region: GQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSS
• Purity/Format: Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description: Rabbit polyclonal antibody to DOHH
• Gene: DOHH
• Conjugate: Unconjugated