| Name | Krtap3-3 antibody |
|---|---|
| Supplier | Biorbyt |
| Catalog | orb326377 |
| Prices | $502.00 |
| Sizes | 100 μl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Goat, Guinea Pig, Dog, Horse, Pig, Sheep |
| Antigen | Synthetic peptide located within the following region: SVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQ |
| Purity/Format | Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description | Rabbit polyclonal antibody to Krtap3-3 |
| Gene | Krtap3-3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |