| Name | GOPC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3007 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA |
| Purity/Format | Affinity purified |
| Description | Rabbit polyclonal GOPC antibody raised against the N terminal of GOPC |
| Gene | C10orf10 |
| Supplier Page | Shop |