Anti-B3GNT8 Antibody (aa360-397)
| Name | Anti-B3GNT8 Antibody (aa360-397) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C407898 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | B3GNT8 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | B3GNTL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
