| Name | RAXLX / ISX antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342399 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Rat |
| Antigen | The immunogen for anti-ISX antibody: synthetic peptide directed towards the N terminal of human ISX. Synthetic peptide located within the following region: ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. |
| Description | Rabbit Polyclonal |
| Gene | ISX |
| Supplier Page | Shop |