RC3H2 / RNF164 antibody
| Name | RC3H2 / RNF164 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329879 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-RC3H2 antibody: synthetic peptide directed towards the middle region of human RC3H2. Synthetic peptide located within the following region: YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR. |
| Description | Rabbit Polyclonal |
| Gene | RC3H2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RC3H2 Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysate