RDH8 / PRRDH antibody

Name RDH8 / PRRDH antibody
Supplier Acris Antibodies
Catalog TA338059
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-RDH8 antibody is: synthetic peptide directed towards the middle region of Human RDH8. Synthetic peptide located within the following region: FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene RDH8
Supplier Page Shop

Product images