RHOX8 / TOX antibody
| Name | RHOX8 / TOX antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341738 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for Anti-Rhox8 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rhox8. Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE. |
| Description | Rabbit Polyclonal |
| Gene | Rhox8 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Rhox8; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml