RHOX11 antibody
| Name | RHOX11 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331440 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11. Synthetic peptide located within the following region: VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFV. |
| Description | Rabbit Polyclonal |
| Gene | Rhox11 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RHOX11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: SP2/0 cell lysate