DDX49 Antibody
| Name | DDX49 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47491 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDX49 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DDX49 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DDX49 Antibody [NBP2-47491] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15911_DDX49-Antibody-Western-Blot-NBP2-47491-img0003.jpg)
Western Blot: DDX49 Antibody [NBP2-47491] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: DDX49 Antibody [NBP2-47491] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15912_DDX49%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47491-img0004.jpg)
Immunocytochemistry/Immunofluorescence: DDX49 Antibody [NBP2-47491] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
![Immunohistochemistry: DDX49 Antibody [NBP2-47491] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15913_DDX49-Antibody-Immunohistochemistry-NBP2-47491-img0002.jpg)
Immunohistochemistry: DDX49 Antibody [NBP2-47491] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.