SUCLG2 Antibody
| Name | SUCLG2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47610 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK |
| Purity/Format | Affinity purified |
| Blocking Peptide | SUCLG2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SUCLG2 |
| Supplier Page | Shop |
Product images
![Western Blot: SUCLG2 Antibody [NBP2-47610] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/20344_SUCLG2%2520Antibody-Western%2520Blot-NBP2-47610-img0003.jpg)
Western Blot: SUCLG2 Antibody [NBP2-47610] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
![Immunocytochemistry/Immunofluorescence: SUCLG2 Antibody [NBP2-47610] - Analysis of human cell line Hep G2 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/20345_SUCLG2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47610-img0001.jpg)
Immunocytochemistry/Immunofluorescence: SUCLG2 Antibody [NBP2-47610] - Analysis of human cell line Hep G2 shows positivity in mitochondria.
![Immunohistochemistry: SUCLG2 Antibody [NBP2-47610] - Analysis of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/20346_SUCLG2-Antibody-Immunohistochemistry-NBP2-47610-img0002.jpg)
Immunohistochemistry: SUCLG2 Antibody [NBP2-47610] - Analysis of human kidney shows strong cytoplasmic positivity in cells in tubules.