ZNF584 Antibody

Name ZNF584 Antibody
Supplier Novus Biologicals
Catalog NBP2-47564
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: LVSSLGLAPSRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERAHP
Purity/Format Immunogen affinity purified
Blocking Peptide ZNF584 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ZNF584
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.