26S proteasome subunit 9 Antibody
| Name | 26S proteasome subunit 9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47561 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | 26S proteasome subunit 9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PSMD9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13260_26S-proteasome-subunit-9-Antibody-Western-Blot-NBP2-47561-img0003.jpg)
Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13261_26S%2520proteasome%2520subunit%25209%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47561-img0005.jpg)
Immunocytochemistry/Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13262_26S-proteasome-subunit-9-Antibody-Immunohistochemistry-Paraffin-NBP2-47561-img0004.jpg)
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.