LONRF3 Antibody

Name LONRF3 Antibody
Supplier Novus Biologicals
Catalog NBP2-47391
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: LMDPAKVKGDGQQHHMKDQEEEEEKWDATSPKAASSKTGKCQEKKRKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDL
Purity/Format Immunogen affinity purified
Blocking Peptide LONRF3 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene LONRF3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.