MMS19 like protein Antibody
| Name | MMS19 like protein Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47371 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MMS19 like protein Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MMS19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MMS19 like protein Antibody [NBP2-47371] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15194_MMS19-like-protein-Antibody-Western-Blot-NBP2-47371-img0003.jpg)
Western Blot: MMS19 like protein Antibody [NBP2-47371] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
![Immunocytochemistry/Immunofluorescence: MMS19 like protein Antibody [NBP2-47371] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15195_MMS19%2520like%2520protein%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47371-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MMS19 like protein Antibody [NBP2-47371] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
![Immunohistochemistry: MMS19 like protein Antibody [NBP2-47371] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15196_MMS19-like-protein-Antibody-Immunohistochemistry-NBP2-47371-img0002.jpg)
Immunohistochemistry: MMS19 like protein Antibody [NBP2-47371] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.