AGPAT6 Antibody
| Name | AGPAT6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85061 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AGPAT6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AGPAT6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: AGPAT6 Antibody [NBP1-85061] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19857_AGPAT6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85061-img0005.jpg)
Immunohistochemistry-Paraffin: AGPAT6 Antibody [NBP1-85061] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.