NECAB1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-84004
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: NECAB1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: NECAB1
• Conjugate: Unconjugated

Product images

Western Blot: NECAB1 Antibody [NBP1-84004] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84004] - Staining of mouse vestibular nucleus shows immunoreactivity in a subset of neurons.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human hippocampus shows nuclear and cytoplasmic positivity in neurons.

Western Blot: NECAB1 Antibody [NBP1-84004] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Western Blot: NECAB1 Antibody [NBP1-84004] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84004] - Staining of mouse hippocampus shows immunoreactivity in a subset of interneurons.

Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84004] - Staining of mouse parietal association cortex shows distinct positivity in layer 4 neurons.

Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84004] - Staining of mouse superior colliculi shows positivity in a subset of neurons.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human lateral ventricle shows moderate cytoplasmic and nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human cerebral cortex shows strong positivity in subsets of neurons.