Cytokeratin 15 Antibody
| Name | Cytokeratin 15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85603 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Cytokeratin 15 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KRT15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cytokeratin 15 Antibody [NBP1-85603] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-143](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17616_Cytokeratin-15-Antibody-Western-Blot-NBP1-85603-img0004.jpg)
Western Blot: Cytokeratin 15 Antibody [NBP1-85603] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-143
![Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human cell line HaCaT shows localization to intermediate filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17617_Cytokeratin-15-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85603-img0005.jpg)
Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human cell line HaCaT shows localization to intermediate filaments.
![Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17618_Cytokeratin-15-Antibody-Immunohistochemistry-Paraffin-NBP1-85603-img0006.jpg)
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.