IP3R1 Antibody
| Name | IP3R1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83105 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IP3R1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ITPR1 |
| Supplier Page | Shop |
![Western Blot: IP3R1 Antibody [NBP1-83105] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: U-87 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/21510_IP3R1-Antibody-Western-Blot-NBP1-83105-img0004.jpg)
![Immunohistochemistry: IP3R1 Antibody [NBP1-83105] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/21511_IP3R1-Antibody-Immunohistochemistry-NBP1-83105-img0003.jpg)