GLMN Antibody
| Name | GLMN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14056 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQG IHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GLMN Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GLMN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GLMN Antibody [NBP2-14056] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 Medium](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11929_GLMN-Antibody-Western-Blot-NBP2-14056-img0003.jpg)
![Immunohistochemistry-Paraffin: GLMN Antibody [NBP2-14056] - Staining of human kidney shows cytoplasmic positivity in cells in glomeruli and in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11930_GLMN-Antibody-Immunohistochemistry-Paraffin-NBP2-14056-img0004.jpg)