dystrophia myotonica containing WD repeat motif Antibody
| Name | dystrophia myotonica containing WD repeat motif Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49548 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DMWD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: dystrophia myotonica containing WD repeat motif Antibody [NBP2-49548] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5631_dystrophia-myotonica-containing-WD-repeat-motif-Antibody-Western-Blot-NBP2-49548-img0003.jpg)
Western Blot: dystrophia myotonica containing WD repeat motif Antibody [NBP2-49548] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue
![Immunocytochemistry/Immunofluorescence: dystrophia myotonica containing WD repeat motif Antibody [NBP2-49548] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5632_dystrophia%2520myotonica%2520containing%2520WD%2520repeat%2520motif%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49548-img0004.jpg)
Immunocytochemistry/Immunofluorescence: dystrophia myotonica containing WD repeat motif Antibody [NBP2-49548] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & actin filaments.
![Immunohistochemistry-Paraffin: dystrophia myotonica containing WD repeat motif Antibody [NBP2-49548] - Staining of human kidney shows strong luminal membranous positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5633_dystrophia-myotonica-containing-WD-repeat-motif-Antibody-Immunohistochemistry-Paraffin-NBP2-49548-img0002.jpg)
Immunohistochemistry-Paraffin: dystrophia myotonica containing WD repeat motif Antibody [NBP2-49548] - Staining of human kidney shows strong luminal membranous positivity in renal tubules.