HspA4L Antibody
| Name | HspA4L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48700 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:KCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HspA4L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HSPA4L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HspA4L Antibody [NBP2-48700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13059_HspA4L-Antibody-Western-Blot-NBP2-48700-img0003.jpg)
Western Blot: HspA4L Antibody [NBP2-48700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
![Immunocytochemistry/Immunofluorescence: HspA4L Antibody [NBP2-48700] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13060_HspA4L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48700-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HspA4L Antibody [NBP2-48700] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
![Immunohistochemistry-Paraffin: HspA4L Antibody [NBP2-48700] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13061_HspA4L-Antibody-Immunohistochemistry-Paraffin-NBP2-48700-img0002.jpg)
Immunohistochemistry-Paraffin: HspA4L Antibody [NBP2-48700] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.