NAPE-PLD Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-48571
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids:ELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: NAPE-PLD Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: NAPEPLD
• Conjugate: Unconjugated

Product images

Western Blot: NAPE-PLD Antibody [NBP2-48571] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: NAPE-PLD Antibody [NBP2-48571] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: NAPE-PLD Antibody [NBP2-48571] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.