Amphiphysin/AMPH Antibody
| Name | Amphiphysin/AMPH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86033 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Amphiphysin/AMPH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AMPH |
| Supplier Page | Shop |
Product images
![Western Blot: Amphiphysin Antibody [NBP1-86033] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/21738_Amphiphysin%2520Antibody-Western%2520Blot-NBP1-86033-img0004.jpg)
Western Blot: Amphiphysin Antibody [NBP1-86033] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunohistochemistry-Paraffin: Amphiphysin Antibody [NBP1-86033] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells, cells of molecular and granular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/21739_Amphiphysin-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0002.jpg)
Immunohistochemistry-Paraffin: Amphiphysin Antibody [NBP1-86033] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells, cells of molecular and granular layer.