ABCF2 Antibody
| Name | ABCF2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89318 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ABCF2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ABCF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ABCF2 Antibody [NBP1-89318] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MCF-7](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7359_ABCF2-Antibody-Western-Blot-NBP1-89318-img0004.jpg)
![Immunohistochemistry: ABCF2 Antibody [NBP1-89318] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7360_ABCF2-Antibody-Immunohistochemistry-NBP1-89318-img0003.jpg)