TCL1B Antibody

Name TCL1B Antibody
Supplier Novus Biologicals
Catalog NBP2-47608
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Purity/Format Immunogen affinity purified
Blocking Peptide TCL1B Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TCL1B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.