WDR70 Antibody
| Name | WDR70 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47581 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VFFERRTFQRVYEIDITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQRKAKQAETLTQDYIITPHALPMFREP |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WDR70 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: WDR70 Antibody [NBP2-47581] - Analysis of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22056_WDR70-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47581-img0001.jpg)
![Immunohistochemistry: WDR70 Antibody [NBP2-47581] - Analysis of human kidney shows extracellular positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22057_WDR70%2520Antibody-Immunohistochemistry-NBP2-47581-img0002.jpg)