WDSOF1 Antibody
| Name | WDSOF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47580 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GIGTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | WDSOF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DCAF13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: WDSOF1 Antibody [NBP2-47580] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus, nucleoli & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7948_WDSOF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47580-img0003.jpg)
Immunocytochemistry/Immunofluorescence: WDSOF1 Antibody [NBP2-47580] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus, nucleoli & cytosol.
![Immunohistochemistry: WDSOF1 Antibody [NBP2-47580] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7949_WDSOF1-Antibody-Immunohistochemistry-NBP2-47580-img0002.jpg)
Immunohistochemistry: WDSOF1 Antibody [NBP2-47580] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.