ZBTB14 Antibody
| Name | ZBTB14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47576 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZBTB14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZBTB14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZBTB14 Antibody [NBP2-47576] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4459_ZBTB14%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47576-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZBTB14 Antibody [NBP2-47576] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
![Immunohistochemistry: ZBTB14 Antibody [NBP2-47576] - Staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4460_ZBTB14-Antibody-Immunohistochemistry-NBP2-47576-img0002.jpg)
Immunohistochemistry: ZBTB14 Antibody [NBP2-47576] - Staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.