ZNF266 Antibody
| Name | ZNF266 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47567 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NLATVGYQLFKPSLISWLEQEESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGIQMIGSHNGGEVSDVKQCGDVSSEHSCLKTHV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF266 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF266 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF266 Antibody [NBP2-47567] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7946_ZNF266%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47567-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ZNF266 Antibody [NBP2-47567] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & vesicles.
![Immunohistochemistry-Paraffin: ZNF266 Antibody [NBP2-47567] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7947_ZNF266-Antibody-Immunohistochemistry-Paraffin-NBP2-47567-img0003.jpg)
Immunohistochemistry-Paraffin: ZNF266 Antibody [NBP2-47567] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center and non-germinal center cells.