C21orf33 Antibody
| Name | C21orf33 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47532 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C21orf33 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C21orf33 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C21orf33 Antibody [NBP2-47532] - Staining of heart muscle tissue. Shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4260_C21orf33%2520Antibody-Immunohistochemistry-NBP2-47532-img0002.jpg)
Immunohistochemistry: C21orf33 Antibody [NBP2-47532] - Staining of heart muscle tissue. Shows strong cytoplasmic positivity in myocytes.