HDGF2 Antibody
| Name | HDGF2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47437 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HDGF2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HDGFRP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: HDGF2 Antibody [NBP2-47437] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6208_HDGF2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47437-img0003.jpg)
![Immunohistochemistry: HDGF2 Antibody [NBP2-47437] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6209_HDGF2-Antibody-Immunohistochemistry-NBP2-47437-img0002.jpg)