FAM84B Antibody
| Name | FAM84B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47459 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVINSFLTDASQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM84B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM84B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FAM84B Antibody [NBP2-47459] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line MCF-7](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7960_FAM84B%2520Antibody-Western%2520Blot-NBP2-47459-img0002.jpg)
![Immunohistochemistry: FAM84B Antibody [NBP2-47459] - Staining of human stomach, lower shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7961_FAM84B-Antibody-Immunohistochemistry-NBP2-47459-img0001.jpg)