MANBA Antibody
| Name | MANBA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47384 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MANBA Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MANBA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: MANBA Antibody [NBP2-47384] - Staining human cell line A549 shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7940_MANBA-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47384-img0001.jpg)
![Immunohistochemistry: MANBA Antibody [NBP2-47384] - Staining of human prostate shows strong cytoplasmic positivity, with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7941_MANBA-Antibody-Immunohistochemistry-NBP2-47384-img0002.jpg)