MFSD12 Antibody
| Name | MFSD12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47376 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FLAWRRGRGEDKGPGYSWIPTVLVQPPRPTSPFLWEAPLAWRCTRKKWSGAGTKPWPRED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MFSD12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MFSD12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MFSD12 Antibody [NBP2-47376] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7979_MFSD12%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47376-img0003.jpg)
Immunocytochemistry/Immunofluorescence: MFSD12 Antibody [NBP2-47376] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry: MFSD12 Antibody [NBP2-47376] - Staining of human testis shows strong cytoplasmic positivity in Leydig cell and cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7980_MFSD12-Antibody-Immunohistochemistry-NBP2-47376-img0002.jpg)
Immunohistochemistry: MFSD12 Antibody [NBP2-47376] - Staining of human testis shows strong cytoplasmic positivity in Leydig cell and cells in seminiferus ducts.